Cargilintide (5 MG)

$129.00

Out of stock

100% Satisfaction Guaranteed

Free Shipping On Orders Over $100

3rd Party Tested

Secure Ordering

Custom Boxes Orders of 3 or More Bottles

Frequently Bought Together

Properties

Chemical Formula:C194H312N54O59S2
Molecular Weight:4409.01 g/mol
Sequence:XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
Concentration:5 MG (1 vial)
Physical Form:White lyophilized powder
PubChem:Cargilintide

 

Terms

This material is sold for laboratory research use only. Terms of sale apply. Not for human consumption, nor medical, veterinary, or household uses. Please familiarize yourself with our terms and conditions prior to ordering

Additional Information

  • Freeze dried powder inside of a sterile 3ml vial.
  • Butyl rubber stopper for multiple penetrations while maintaining a secure seal.
  • RTF vials are Depyrogenated, and ETO Sterilized.
  • Tamper evident aluminum flip top.

Disclaimer

Products are furnished for LABORATORY RESEARCH USE ONLY. This product should only be handled by qualified, and licensed professionals. The product may not be used as a drug, agricultural or pesticidal product, food additive or household chemical – and may not be misbranded as such. All information on this website is available for educational purposes only. Bodily introduction of any kind into humans and/or animals is strictly forbidden by law.

You are not old enough to view this website

You must be 21+ to view our website.

Compounds offered on sigmacompounds.com are for research purposes only.

Are you 21+ years of age & a qualified professional?

By proceeding, you affirm that you are at least 21 years old and possess the qualifications of a trained professional.

Become A Sigma And Receive: