Chemical Formula: | Tesamorelin: C223H370N72O69S Ipamorelin: C38H49N9O5 |
Molecular Weight: | Tesamorelin: 5195.908 g/mol Ipamorelin: 711.868 g/mol |
Sequence: | Tesamorelin: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL Ipamorelin: Aib-His-D-2Nal-D-Phe-Lys |
Concentration: | 8mg (1 vial) |
Physical Form: | White lyophilized powder |
Solution: | Transparent Solution |
PubChem: | Tesamorelin |
This material is sold for laboratory research use only. Terms of sale apply. Not for human consumption, nor medical, veterinary, or household uses. Please familiarize yourself with our terms and conditions prior to ordering
Products are furnished for LABORATORY RESEARCH USE ONLY. This product should only be handled by qualified, and licensed professionals. The product may not be used as a drug, agricultural or pesticidal product, food additive or household chemical – and may not be misbranded as such. All information on this website is available for educational purposes only. Bodily introduction of any kind into humans and/or animals is strictly forbidden by law.
At Sigma Compounds, our products are intended solely for research and development purposes and are not for human consumption.
The information on this website has not been reviewed by the U.S. Food and Drug Administration (FDA) and is not intended to diagnose, treat, cure, or prevent any disease.
Sigma Compounds is a chemical supplier and is not a compounding pharmacy or facility under Section 503A of the Federal Food, Drug, and Cosmetic Act, nor an outsourcing facility under Section 503B.