Tesamorelin/Ipamorelin (6/2 MG)

Original price was: $108.00.Current price is: $97.00.

Out of stock

100% Satisfaction Guaranteed

Free Shipping On Orders Over $100

3rd Party Tested

Secure Ordering

Custom Boxes Orders of 3 or More Bottles

Frequently Bought Together

Properties

Chemical Formula:Tesamorelin: C223H370N72O69S

Ipamorelin: C38H49N9O5

Molecular Weight:Tesamorelin: 5195.908 g/mol

Ipamorelin: 711.868 g/mol

Sequence:Tesamorelin: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Ipamorelin: Aib-His-D-2Nal-D-Phe-Lys

Concentration:8mg (1 vial)
Physical Form:White lyophilized powder
Solution:Transparent Solution
PubChem:Tesamorelin

Ipamorelin

Terms

This material is sold for laboratory research use only. Terms of sale apply. Not for human consumption, nor medical, veterinary, or household uses. Please familiarize yourself with our terms and conditions prior to ordering

Additional Information

  • Freeze dried powder inside of a sterile 3ml vial.
  • Butyl rubber stopper for multiple penetrations while maintaining a secure seal.
  • RTF vials are Depyrogenated, and ETO Sterilized.
  • Tamper evident aluminum flip top.

Disclaimer

Products are furnished for LABORATORY RESEARCH USE ONLY. This product should only be handled by qualified, and licensed professionals. The product may not be used as a drug, agricultural or pesticidal product, food additive or household chemical – and may not be misbranded as such. All information on this website is available for educational purposes only. Bodily introduction of any kind into humans and/or animals is strictly forbidden by law.

Become a Sigma and receive 10% off every order and more